PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.B8XSH
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family ZF-HD
Protein Properties Length: 220aa    MW: 24207.7 Da    PI: 6.6243
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.B8XSHgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer100.51.2e-3168122459
  ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                  vrY+eClkNhAa++Gg+a+DGCgEfmps g++gt++al+C+AC CHRnFHR+e + 
  Araip.B8XSH  68 VRYRECLKNHAAAMGGNATDGCGEFMPS-GDHGTMEALTCSACRCHRNFHRKEIQG 122
                  89*************************9.889********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257742.0E-2468126IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047705.1E-2868120IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.2E-2969120IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.04970119IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MELSSQEGDI PIAVNTTANY GGNGHGAHIN IHHTQNPSNG SSMHPLDNGP YNSKQEEEEE  60
EEVVVPLVRY RECLKNHAAA MGGNATDGCG EFMPSGDHGT MEALTCSACR CHRNFHRKEI  120
QGEPSAPPPP LLEYHHHHFN TATRHLAASR KFLHKNMHHH HHLGYPTAGG GNILPSRTVP  180
PAQMIMPYNI GPMPSSEHSD EQDERVKTAT RLESNAESSR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016177381.11e-154PREDICTED: LOW QUALITY PROTEIN: zinc-finger homeodomain protein 4
TrEMBLA0A151SB961e-53A0A151SB96_CAJCA; ZF-HD homeobox protein At4g24660 family
STRINGGLYMA07G40190.15e-52(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20634253
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.21e-32homeobox protein 31